SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|518652152|ref|YP_008141672.1| from Ferroplasma acidarmanus fer1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518652152|ref|YP_008141672.1|
Domain Number 1 Region: 3-56
Classification Level Classification E-value
Superfamily TrpR-like 0.00000000000481
Family SPO1678-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518652152|ref|YP_008141672.1|
Sequence length 89
Comment transposase [Ferroplasma acidarmanus fer1]
Sequence
MEKFTADEKVAIVMESFTANNIAELCRRHGVSVSNFYKWRDKFIESGKKGFYGSGVNNGY
EKEIDKLKRLVGDQALVIDELKKNYRGRR
Download sequence
Identical sequences S0APH2
gi|518652152|ref|YP_008141672.1| gi|518653122|ref|YP_008142642.1| WP_019841506.1.98901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]