SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm10915 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm10915
Domain Number 1 Region: 13-184
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-34
Family G proteins 0.00011
Further Details:      
 
Weak hits

Sequence:  Bm10915
Domain Number - Region: 185-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000366
Family SOCS box-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm10915
Sequence length 280
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3:502597:504930:-1 gene:WBGene00231176 transcript:Bm10915 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm10915
Sequence
MRIGASELCREEHECMLKFLLVGDSDVGKDEIADFLGPSVSYTPDALFIPFAVPKTTVIL
LEGKFVRLELWDASGQGRFSTIIKSYSRGVQGILLVYDITNRWSFDGIRRWLAEIDEHAP
GVPKILIGNRLHLEFNRAVPRREAECFARKRNMQYFEISTLAYFNVHESITELARLVISR
NGMHRLWKCAQVASLQDLCCRAIIKNISNVHAIDRLLLPLFLQLKVRSFASGADLCMRSV
IRRHYATPYFSSASKYITRFVRARDTSTKDHLRNANCDLM
Download sequence
Identical sequences A0A0H5SCZ0
Bm10915 Bm1_40885 XP_001899637.1.25112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]