SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11038c from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11038c
Domain Number 1 Region: 6-113
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000137
Family Ankyrin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm11038c
Sequence length 123
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold108:53826:54673:-1 gene:WBGene00231299 transcript:Bm11038c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11038
Sequence
MLRQIVRDGARLDIPDDTRGRIPLHFAISCEFWCRVKTLLHLRSPVNTEDKDKKTPLHLA
ILTPRAPNFEVTKTIYLLLEYGADVNEVIRKMTPLRNRYLSNLIDHQQRLSEAFDEARMK
TLV
Download sequence
Identical sequences A0A1I9G720
Bm11038c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]