SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11213 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11213
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-48
Family G proteins 0.000000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm11213
Sequence length 168
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold6479:169:1157:1 gene:WBGene00231474 transcript:Bm11213 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-rho-1
Sequence
XKTCLLIVFSKDQFPDVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPD
TDVILMCFSIDSPDSLENIPEKWTPEVRHFCPNVPIILVGNKKDLRNDPQMVRELAKMKQ
EPVRPEQGRAIAEQIGAFAYLECSAKTKDVSSFSKLIVSNNSILLNVT
Download sequence
Identical sequences Bm11213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]