SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11318 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11318
Domain Number 1 Region: 7-65
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000655
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm11318
Sequence length 174
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold4301:1:1433:-1 gene:WBGene00231579 transcript:Bm11318 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11318
Sequence
XLLLWDRDQRSYNYYVEISMDQEVWIRVVDHSNYLCRSRQMLYFTPRVVNFIRIVGTYNT
VNNSFHLVSIEAMYTSEPFDVDPVTTLLVPSANVATIANNAIVIEGVSRSRNALINGETS
NYDWDNGYTCHQLGSGAIIVQLPQPYLIDSMRLLLWDCDDRHYSYYVEVSCDNT
Download sequence
Identical sequences Bm11318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]