SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11346 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11346
Domain Number 1 Region: 4-113
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000423
Family Tandem AAA-ATPase domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm11346
Sequence length 117
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold5879:266:1026:-1 gene:WBGene00231607 transcript:Bm11346 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11346
Sequence
XTARKKLNDIFQYHDKKRLPIIVLVDELDLLNTKRQEIIYDIFNWSANEESLVSVIAIAN
TLDLPERLFSQRVSSRLGANRLCFQPYDHDEVAYIIRDRLRNSTAVEAEAIELASRK
Download sequence
Identical sequences Bm11346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]