SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11551 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11551
Domain Number 1 Region: 99-169
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000028
Family Ankyrin repeat 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm11551
Sequence length 171
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold2949:438:1589:1 gene:WBGene00231812 transcript:Bm11551 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11551
Sequence
NATTICKPEIIHEEEKEATDDDTTTTAPEYVCELLMKDIQLDELPVEIEQMEECKQMKVL
TEKEFTDEIEMQKETSNITNLIKTSPEKGILCHNKVKKAARKVVFDPLALLLDAALEGEM
DLVKSSAAKLPNISACNDEGITALHNAICAGHYEIVRYLVDSFADVNAQVC
Download sequence
Identical sequences A0A1I9GA58
Bm11551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]