SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11565 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11565
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000714
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 75-161
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000847
Family Growth factor receptor domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm11565
Sequence length 180
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3205:62:1422:1 gene:WBGene00231826 transcript:Bm11565 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-fbl-1
Sequence
XINECESSQEICHKQSHCINAIGDYICERNCQPGFKVDSRGDCKDIDECALGMHNCTSGV
LCKNIPGAFLCEASLCAEGYIRDSSGHCKDVDECDKLLCGNLKCLNHLGSYNCICPTSFP
NDIDGICEETKENLANVKSIRFDENWRTCAPGYYRIGETCQGTNFNLILKVKLQSYISSN
Download sequence
Identical sequences Bm11565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]