SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11674 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11674
Domain Number 1 Region: 31-119
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000497
Family Ankyrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm11674
Sequence length 150
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold4948:238:1331:1 gene:WBGene00231935 transcript:Bm11674 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11674
Sequence
MQSGKKSICSDDGDTRKWLLGHLHIIQAKALASNLDLPKIYKEKIEAVPDSNPNEINLNG
ESLLIATIKYLDDKENRLKYIQLLIDRGAEINFQDKRERRTALMYACIEDNRTEEGLLIA
KIFKNNLKIYECKIHICVYICMCVCVCVCV
Download sequence
Identical sequences A0A0H5SRW5
Bm11674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]