SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11721 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11721
Domain Number 1 Region: 94-190
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000595
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.02
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000764
Family Complement control module/SCR domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm11721
Sequence length 202
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold8308:134:979:1 gene:WBGene00231982 transcript:Bm11721 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm11721
Sequence
VGSAFTFSCRPPYSLIGKSSYDDRTIRCNVDGNWDLGDLRCEGPVCVDPGFPDDGQIQLE
SVEEGAQAKFTCNRAGYKPFPSDTINCTLGTACVLAEDVGISSGFIPDGAFADNSDSTTW
GYEPHKARLSSTGWCGSKDAFIFLSVDLQRIYTLTTLRMAGVAGSGHLRGHITKMQLFYK
VQYSQNYDTYPIVCYVFVFLFF
Download sequence
Identical sequences A0A1I9G9N7
Bm11721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]