SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm12028 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm12028
Domain Number 1 Region: 12-163
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.1e-22
Family Ankyrin repeat 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm12028
Sequence length 164
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold4659:266:1181:-1 gene:WBGene00232289 transcript:Bm12028 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm12028
Sequence
ALLNVRGHTLIQPNTHDTVLHAAISSQKAIIVEMILKAFTHLVTAKNADGSTALHCASQC
GSLDIVKLLLEFPYEEDVLTKIEDISGRFSYRFVLNVNGLDAHCRTALYLAVANSYYDIV
KYLLEVEFPSMDIDQKCPFEIDVYCSGGKTPLMVAAANGDIALV
Download sequence
Identical sequences A0A1I9GDX2
Bm12028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]