SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm12207 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm12207
Domain Number 1 Region: 2-88
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-21
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm12207
Sequence length 126
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold7079:70:891:1 gene:WBGene00232468 transcript:Bm12207 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm12207
Sequence
NGEDANESDNLGFTALYHAAAHNYTEICKILIENGALIDAHGGELCETALHAAVRWQAVD
VVEYLLSKGANRRARNLKDETPMDLIKDDEMRAVFGRISHPIQMGTINLARSKNGHDEVY
SFRVDQ
Download sequence
Identical sequences A0A1I9GB14
Bm12207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]