SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm12340 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm12340
Domain Number 1 Region: 10-126
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000173
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm12340
Sequence length 127
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3213:412:1280:1 gene:WBGene00232601 transcript:Bm12340 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm12340
Sequence
KTALGIASSNCHCDENAECTGGVCKCKSGWTGDGKSCVDINECFGESNICGAHAICENSL
GSYSCQCNIGYIFDRNGKCIDLDECAEGIVVCGGSKNSSICVNIDGGYECRCAPGYAGSP
DSPHGCV
Download sequence
Identical sequences A0A1I9GB94
Bm12340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]