SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm12375 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm12375
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000604
Family Ankyrin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm12375
Sequence length 130
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold2595:620:1692:1 gene:WBGene00232636 transcript:Bm12375 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm12375
Sequence
NGCNFHAQDRLGNTALMYAAMKGRDELMNFMVDTLAKGWSLAALQLTNCMGHTAEDLEIR
NGQHRCARMVQTQRLHLLACLNRQMGMVGQIGCRYWGAFAAIYKCVDKLVSIFCFLFVNY
CHPESKKKEF
Download sequence
Identical sequences A0A1I9GBL1
Bm12375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]