SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm12647 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm12647
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily ARM repeat 6.04e-27
Family Diap1 N-terninal region-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm12647
Sequence length 147
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold6182:339:1198:1 gene:WBGene00232908 transcript:Bm12647 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm12647
Sequence
FLESCTLEAIKKQYDNFCRIKEADFAELVNRFEQIKGEYEEPDCCYSILLAGVKNTRAEG
PFLSILQHLLLVTDDIGVRTEYFRLIENCISEIVLPKTCVDPDFRGKFEFTQDITHFLDT
LEDGEEGRQANKRVEIATQAKNEALAK
Download sequence
Identical sequences A0A1I9G9B3
Bm12647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]