SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1770a from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1770a
Domain Number 1 Region: 465-853
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.1e-125
Family Ankyrin repeat 0.00000000157
Further Details:      
 
Domain Number 2 Region: 230-480
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.83e-69
Family Ankyrin repeat 0.00000393
Further Details:      
 
Domain Number 3 Region: 76-293
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.44e-54
Family Ankyrin repeat 0.0000253
Further Details:      
 
Domain Number 4 Region: 1517-1606
Classification Level Classification E-value
Superfamily DEATH domain 9.76e-16
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1770a
Sequence length 1942
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold25:253051:274024:1 gene:WBGene00222031 transcript:Bm1770a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-unc-44
Sequence
MFLLSSWYMVTKRSARGHITGSTTDKKRVTNKTQLLMINPAVEAGGWPAEVPKSQQQQVP
SDNSQHSNKGESSASFLRAARAGNLDRVLELLRLGTDINTCNANGLNALHLASKEGHHEV
VRELLKRKADVDAATKKGNTALHIASLAGQELIVTILVENDANVNVQSLNGFTPLYMAAQ
ENHESVVRYLLAHSANQALATEDGFTPLAVALQQGHDRVVALLLENDTRGKVRLPALHIA
AKKDDTKAATLLLQNEHNSDVTSKSGFTPLHIAAHYGNENVALLLLEKGANVNYQARHNI
SPLHVATKWGRANMVSLLLAHGAVIDCRTRDLLTPLHCASRSGHDQVVDLLLEKGAPINA
KTKNGLAPLHMAAQGDHVDSARILLYHRAPVDDVTVDYLTPLHVAAHCGHVRVAKLLLDR
NADSNARALNGFTPLHIACKKNRIKVVELLLKYHAAIEATTESGLSPLHVAAFMGAINIV
IYLLQQGANANVATVRGETPLHLAARANQTDIVRVLVRNGAQVDAAARELQTPLHIASRL
GNTDIVILLLQAGASPNAATRDLYTPLHIAAKEGQEEVAAILIDHGSDKTLLTKKGFTPL
HLAAKYGNLPVAKLLLERGTLVDIEGKNQVTPLHVAAHYNNDKVALLLLESGASAHAVAK
NGYTPLHIAAKKNQMDIASTLLHYRANANAESKAGFTPLHLSAQEGHREMAALLIENGAK
VGAQARNGLTPMHLCAQEDRVNVAEELVKENAATDSKTKAGYTPLHVACHFGQINMVRFL
IEHGAPVSATTRASYTPLHQAAQQGHNNVVRYLLEHGASPNVQTSTGQTPLSIAERLGYV
SVVEALKTVTETTVITETTTITEERYKPQNPEAMNETMFSDSEDEAPNTLEEDASHLRVL
THSPLRLSTDDHDLSFFPNHTSSPYPSPGATLIYLSRDDNQITANAHAHDFSESLTKGLH
DSTGVHLIHATEPMLSKSPEVEGVDGDLDALIRKAQHEPVTTAMVDPSLDSSLSDSVPVT
RTTVQPSFLISFMVDARGGAMRGCRHSGVRIIIPPRKAPQPTRVTCRYLRKDKLAHPPPL
SEGEALASRILEMAPHGVKFLGPVILEVPHFASLRGREREIVILRSDDGQHWKEHQLEAT
EDAVQEVLNESFDAEELSQLDDLHTSRITRILTNDFPMYFAVVTRVRQEVHCVGPEGGVI
LSSVVPRVQAIFPDGSLTKTIKVSVQAQPVPQEIVARLHGNRVAVSPIVTVEPRRRKFHK
PITLCIPLPQSSNKGMLTQYSGQPGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGE
DVSFTTTVSARFWLMDCQTPRDAARMAQEVYNEAISVPYMARFLIFARRTFPNEGQLRLF
CMTDDREDKTLEKQEHFIEIAKSKDVEVLSGRHQFLEFSGNIFPITKSGDQLSLYFLPFQ
ENRLAFMIKTRARTDNEAAADGRISFMKEPKMRAESLPPQTPLCTLAVTLPEYTGPISKK
PFFSEALLTEKYTEALHETAEPDDLPLPHVARLIGADWHRLARALEVPDIDIRQVRHQLV
GLEAITVLRIWMFLKKEQATPAILRSALQRIGRDDVVREINRIEKPDDLEGTPVSHISEP
SVTISSTSLEADDRRHYSEVAATQQLMVEEPFFQQSEYYGIDGDTGGPKEQPFREEEEEV
AVSEIRTVVRTERHVHDSEDGERCFDTGPIVEERTITTTYEDDVAVNEEIVDRIVPLNEE
EQEKWDRMVREAEMNLEQQKESKEGTLDSQVTHEEKKDGDDGVILKTTRMGSSHVSQFLP
DEAKTAANETGLSSRDASIVMTPTGEEKVDHIGVREPSLSSAEPNIPTVTDQRHEAMAEG
FTSEDGSVVVSKKMTRVVTTTRTTFPGEKTESNMGDLIRLKVNEQVYSGSVDPGDQHIHL
VPITKQRQQQKLDSSDQQQQQH
Download sequence
Identical sequences A0A0K0J303
Bm1770a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]