SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1895 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1895
Domain Number 1 Region: 9-225
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.57e-43
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 2 Region: 248-318
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000383
Family Ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1895
Sequence length 322
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold75:4159:8318:1 gene:WBGene00222156 transcript:Bm1895 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm1895
Sequence
MNSISIEQFLIACETWNLDEVRQAVESGFLVDTFDDDHVTGLQMAAATGNIGIVQYLLDH
GADIEKSNQVGMTALHHAAKNGHANIVRILVQRGANYQKLTYLGASAMTLAAASGHTDLI
KLLLDLNVSVNPTHTALCPTPIIAAAFRRHTHLCALLSQKGAYLDGNIPRLSNLSALSTA
ITCGATTIVGALLELGANPSFRSLNGMTSTELAQHLQQNEVLTVINSTFRNILKKEEEQI
EVDLRQLIYRNDENAIRMILDRHLSYVPFPENTTPLMYAVLLADNNIVKIIRESNITDIN
AAENVSGLTALMFAAIIGYVIN
Download sequence
Identical sequences A0A0H5S7G2
Bm1895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]