SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1952 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1952
Domain Number 1 Region: 139-363
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-41
Family Ankyrin repeat 0.00044
Further Details:      
 
Domain Number 2 Region: 439-504
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000577
Family DEATH domain, DD 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm1952
Sequence length 516
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold9:270819:274617:1 gene:WBGene00222213 transcript:Bm1952 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-ikb-1
Sequence
MVEAATPCASSVIVSDIMHRDNAPLKVIEVSHNIVRNTKETIWLLLSKPVANVSISIAIG
NRMLPVERLKTHDKLVIFSLPILVIPDKVDKTSPATKSFKILMRSDTQQLELPMQVHVSA
TSNASDTAEIVDKEALIASLFEFAAEGEPLALVKPLVTLLGTPDNDGCNALHVAARNKQN
FALKTILSVLCEILNAPNVRGQTALHCAVRAGDADCVHYLISAGAKRNVVDNNLDTVAHY
LGEAYNDAIYKEILETSSIEINRENILAKKNCYGYTPAHVAVKKLKLSLLEALIEAGAPV
DIPDNNGETPLLTALYMDDADAASLLAQHNCDVNVVSNCGDTPLKIACKKKNLVMIGCLL
DAGSTMDSLGTGDGRPIEADDEDVQRILNGERVEVPSVYAQDDPGEQEINELQSEESIST
ATSTDAATSYRLRTLKDDVSCLDYLTRLRLSKILDVEDKWTILADHLGCGHMVEFIRVCL
DDSSSPTMMLLDQYESLEDMGETLGVRLIQAGNEQQ
Download sequence
Identical sequences A0A0J9XQC1
Bm1952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]