SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2191b from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2191b
Domain Number 1 Region: 98-169
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000000000629
Family F-box associated region, FBA 0.0016
Further Details:      
 
Domain Number 2 Region: 31-113
Classification Level Classification E-value
Superfamily F-box domain 0.000000131
Family F-box domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm2191b
Sequence length 231
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold96:112659:114402:1 gene:WBGene00222452 transcript:Bm2191b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm2191
Sequence
METVTWSSRSENDEEIDEEGKSDIYLHGVPIPPQILAEILVRVDGRRDVGYICPLVCRRW
YNVLSAPGFWISYMIYRSMDLPPSFLRNEPSLNVKKVSLQQAFGRNLISNPSGDDGYQNW
EIYEDGGDEFEIEKPPVGCIALEEIPVAFVTSYDWCSKFQIIDLWKEGIEVVSIAHRFIY
WKYNCFLMDLYLCHIEQCQDFFFILGILVFLNNMIDYSMVCHKMMKQPILQ
Download sequence
Identical sequences A0A0K0J4V6
Bm2191b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]