SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2421 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2421
Domain Number 1 Region: 29-71,99-391
Classification Level Classification E-value
Superfamily Glutaminase/Asparaginase 1.03e-98
Family Glutaminase/Asparaginase 0.000000108
Further Details:      
 
Domain Number 2 Region: 428-607
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.44e-39
Family Ankyrin repeat 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm2421
Sequence length 615
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold6:892960:897765:-1 gene:WBGene00222682 transcript:Bm2421 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm2421
Sequence
ISYTAFAVKIFVPVIMLISVGSIMSTIHGEEARVLVLYTGGTIGMKCIDGVYRPEANYLL
RAMRNMPLLNDCDYVSTNYADAKTKPYCLPSLQHSKKRLVYWVVEYDPLLDSSDMTFDDW
IKIGKDIQEAYDQYVGFVILHGTDTLAYTACALSFMLENVGKPVVITGAQIPVFEVRSDG
RENLIGALIMAAYYDIPEVTVYFNNKLFRGNRTIKVDNSSLEAFESPNMLPIAHMDIDIK
VNYDSIFRSPSVAPFVIHDRLCRNVGLLRIFPSISIENVRASLQPPTEGVVLQTFGAGNM
PSHRTDIIDELKKAIDRGCLIINCSQCVRGQVDVQYLTGKILYDIGVIPGSDMTTEAALT
KLSYVLSKDCWGLSKKKAMMVKNIRGELTVTQPKPLRDLEIVSQIARFLHLNTSHELEFL
RHAILPQLLCHAADSGNVELLRAIRENGANLSAIDYNGRNALHIAASAGHVDAVKYLLTQ
GVSFQLRDQRDENALVAAVRTKNKVCIETLRSAGAVLSISPFQLGVELCLCASCGDIETL
NSWLAAGADINQQDYGGRTALHIAVESRNKQLIYYLLGRGADPDKSDYFDLTPLGHAKKL
NLQDLVIKMKKREVQ
Download sequence
Identical sequences A0A1I9GCV5
Bm2421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]