SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3148a from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3148a
Domain Number 1 Region: 993-1233
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.44e-56
Family Ankyrin repeat 0.0000115
Further Details:      
 
Domain Number 2 Region: 416-548
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 312-355
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000709
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 544-585
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000122
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 350-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000149
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 29-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000056
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 7 Region: 110-227
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000596
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 1-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000315
Family EGF-type module 0.018
Further Details:      
 
Domain Number 9 Region: 639-669
Classification Level Classification E-value
Superfamily Notch domain 0.00000144
Family Notch domain 0.0059
Further Details:      
 
Domain Number 10 Region: 676-707
Classification Level Classification E-value
Superfamily Notch domain 0.00000497
Family Notch domain 0.0029
Further Details:      
 
Domain Number 11 Region: 65-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000837
Family EGF-type module 0.022
Further Details:      
 
Domain Number 12 Region: 597-629
Classification Level Classification E-value
Superfamily Notch domain 0.0000109
Family Notch domain 0.0016
Further Details:      
 
Domain Number 13 Region: 239-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000011
Family EGF-type module 0.036
Further Details:      
 
Domain Number 14 Region: 272-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000192
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3148a
Sequence length 1430
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold7:107980:119977:-1 gene:WBGene00223409 transcript:Bm3148a gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3148
Sequence
MNGGTCIDREQGYECKCPPFYTGRFCEEDIDECELGLHECKNGATCFNKKEGYQCVCVNG
WEGIHCEINKDDCKDALCEAGSTCVDHLAKYTCECPPGRIGLLCHMEDPCLSNPCQVGSV
CEPDTSSGKYTCECPKGYTGEDCSNDINECNQDHAVCYNGGTCVNTPGSFHCECPPGYTD
WHCQTHVNQCSTNPCLNSGTCLDYGTRFKCVCMSGFHGKRCELHCPSGYEGENCERRQYI
ECSITDCLNGGVCSKGSCRCPPGFTGDRCEKKLDPCKYHNCPQNAICIPINNSVTYKCEC
KLGFYGHDCKLEMNECASNPCQHGGVCTDHLNGYVCSCSAGYTGEQCQTNIDDCIHHPCL
HGGTCIDGINSYSCHCALPYDGDRCQYELDPCRTNRCENGAICKPTPTYRNYTCSCTNGF
YGYYCDTDIDECAVNNPCLNGGTCANKFGSYHCRCSDGYTGRNCESDRDDCLPNPCLNGG
HCMDELNGYHCECLAGFTGRQCATNINECESSPCENGASCIDHINGFECVCRRGFSGTFC
QTNDDDCQPGLCLNGGTCVDGVNSYRCRCQRGFTGKNCQHQIDLEQFNVTDLLEHELCAK
HDCITKAGNKVCDQVCNYYACHYDSGDCSAGTKPFEKCESPSYCAHVFRDGKCDPICNNQ
ECLFDGFDCDSIPEQCSKNDYCTTHYADGQCDRECNVIGCGWDGGDCDSFDVETPLEGNI
IVILLISPDEFLHNAQTFLFTLSQKLRGAVHIRTINGKPMIYSWSSEGGIGQLYDVAPEK
RYLLVPNLQRVKRQTDQLRGTMVMLTVDVSYCRKIDREECFSDLFSIVDYLGAANAKQEL
QELGMPVHSARVELDNAKQAKGISWQTLLICLLIFVTTVLIAYSMVQQGRKRKTLHARIW
HPPPSESCKSSTGNLDTYSIHSGYLFSNYGTAKRSRADNIPVGIAHPNLYIGEDTQSFLK
PKTLSTDERQWTHLHEAADSTIPISLPIEPLLVNVRGKHGRTPMMQTASNQAKNEEASCE
DIRNLLEAGAEIDAQDDSEDTALMLAVKSGRTTVVDCLLKNGADPTIVDEKDRTPLHHAV
AVNIPNIVQLLLDTRQVNVDALDEDNRTPLIICSKFDIRMGTEIAEMLLKAKADVACAGD
KSLTKYDGRTALHFASQHANLDIIRLLIHNGANKDAQDSLDQTPLFLAASEGHLDAVECL
ISLGASKEITDQKERSPRDIAAEKEFRDIVHYLDTVPTPRILPSNMAATLALSTHQRFKK
SFKKTTRPVIKKNPSPTYPSAVTALTAQPATSVNPLTPPNSDGSNYSTTPSPHDTTAVVH
GGTAATRGTTVAQATAGHPENAVLQSSSVMLSPYSDHHNGTGCSPPQMMTAMQAGWLFPA
NQSSHQQYEEGLFYGTGMLPFVYDQRTLRPSYSQSHMPHVQQPSTAYYNV
Download sequence
Identical sequences A0A0J9XRA3
Bm3148a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]