SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3148f from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3148f
Domain Number 1 Region: 1223-1462
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.26e-56
Family Ankyrin repeat 0.0000115
Further Details:      
 
Domain Number 2 Region: 362-505
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000576
Family Growth factor receptor domain 0.0041
Further Details:      
 
Domain Number 3 Region: 541-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000218
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 4 Region: 696-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000316
Family EGF-type module 0.004
Further Details:      
 
Domain Number 5 Region: 734-776
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000108
Family EGF-type module 0.0045
Further Details:      
 
Domain Number 6 Region: 773-814
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000138
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 7 Region: 258-297
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000682
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 8 Region: 657-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000945
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 9 Region: 220-263
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000119
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 181-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000735
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 579-621
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000837
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 12 Region: 138-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000136
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 13 Region: 104-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000146
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 14 Region: 616-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000367
Family EGF-type module 0.012
Further Details:      
 
Domain Number 15 Region: 65-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000014
Family EGF-type module 0.0073
Further Details:      
 
Domain Number 16 Region: 868-898
Classification Level Classification E-value
Superfamily Notch domain 0.0000017
Family Notch domain 0.0059
Further Details:      
 
Domain Number 17 Region: 337-373
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.013
Further Details:      
 
Domain Number 18 Region: 905-936
Classification Level Classification E-value
Superfamily Notch domain 0.00000589
Family Notch domain 0.0029
Further Details:      
 
Domain Number 19 Region: 501-545
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000114
Family EGF-type module 0.029
Further Details:      
 
Domain Number 20 Region: 294-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000126
Family EGF-type module 0.022
Further Details:      
 
Domain Number 21 Region: 826-858
Classification Level Classification E-value
Superfamily Notch domain 0.0000128
Family Notch domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3148f
Sequence length 1659
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold7:107980:126049:-1 gene:WBGene00223409 transcript:Bm3148f gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3148
Sequence
MEILRVGELKSRVWTRRDRNLEMNKKEKMERSGMDKTKIRQIKRENWLKSKYFSGFNGTL
CEYRQPSRCDEAPCVHGRCILSKSLDTFRCECQIGFTGERCDRRNYCEGNPCRNGGSCIS
TTGGYRCGCPEGFHGNKCELDINECHLNPCVRGKCINEFGSYRCDCPHDFTGRNCETLLF
NIDPCSTSPCHNNAKCYTYRDKYYSCECRPGFTGRHCEVNIDDCSENACMNGGTCIDREQ
GYECKCPPFYTGRFCEEDIDECELGLHECKNGATCFNKKEGYQCVCVNGWEGIHCEINKD
DCKDALCEAGSTCVDHLAKYTCECPPGRIGLLCHMEDPCLSNPCQVGSVCEPDTSSGKYT
CECPKGYTGEDCSNDINECNQDHAVCYNGGTCVNTPGSFHCECPPGYTDWHCQTHVNQCS
TNPCLNSGTCLDYGTRFKCVCMSGFHGKRCELHCPSGYEGENCERRQYIECSITDCLNGG
VCSKGSCRCPPGFTGDRCEKKLDPCKYHNCPQNAICIPINNSVTYKCECKLGFYGHDCKL
EMNECASNPCQHGGVCTDHLNGYVCSCSAGYTGEQCQTNIDDCIHHPCLHGGTCIDGINS
YSCHCALPYDGDRCQYELDPCRTNRCENGAICKPTPTYRNYTCSCTNGFYGYYCDTDIDE
CAVNNPCLNGGTCANKFGSYHCRCSDGYTGRNCESDRDDCLPNPCLNGGHCMDELNGYHC
ECLAGFTGRQCATNINECESSPCENGASCIDHINGFECVCRRGFSGTFCQTNDDDCQPGL
CLNGGTCVDGVNSYRCRCQRGFTGKNCQHQIDLEQFNVTDLLEHELCAKHDCITKAGNKV
CDQVCNYYACHYDSGDCSAGTKPFEKCESPSYCAHVFRDGKCDPICNNQECLFDGFDCDS
IPEQCSKNDYCTTHYADGQCDRECNVIGCGWDGGDCDSFDVETPLEGNIIVILLISPDEF
LHNAQTFLFTLSQKLRGAVHIRTINGKPMIYSWSSEGGIGQLYDVAPEKRYLLVPNLQRV
KRQTDQLRGTMVMLTVDVSYCRKIDREECFSDLFSIVDYLGAANAKQELQELGMPVHSAR
VELDNAKQAKGISWQTLLICLLIFVTTVLIAYSMVQQGRKRKTLHARIWHPPPSESCKSS
TGNLDTYSIHSGYLFSNYGTAKRSRADNIPVGIAHPNLYIGEDTQSFLKPKTLSTDERQW
THLHEAADSTIPISLPIEPLLVNVRGKHGRTPMMQTASNQAKNEEASCEDIRNLLEAGAE
IDAQDDSEDTALMLAVKSGRTTVVDCLLKNGADPTIVDEKDRTPLHHAVAVNIPNIVQLL
LDTRQVNVDALDEDNRTPLIICSKFDIRMGTEIAEMLLKAKADVACAGDKSLTKYDGRTA
LHFASQHANLDIIRLLIHNGANKDAQDSLDQTPLFLAASEGHLDAVECLISLGASKEITD
QKERSPRDIAAEKEFRDIVHYLDTVPTPRILPSNMAATLALSTHQRFKKSFKKTTRPVIK
KNPSPTYPSAVTALTAQPATSVNPLTPPNSDGSNYSTTPSPHDTTAVVHGGTAATRGTTV
AQATAGHPENAVLQSSSVMLSPYSDHHNGTGCSPPQMMTAMQAGWLFPANQSSHQQYEEG
LFYGTGMLPFVYDQRTLRPSYSQSHMPHVQQPSTAYYNV
Download sequence
Identical sequences A0A1U7F0L0
Bm3148f

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]