SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3293 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3293
Domain Number 1 Region: 297-630
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-94
Family Subtilases 0.000000000388
Further Details:      
 
Domain Number 2 Region: 624-766
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-39
Family Proprotein convertase P-domain 0.000094
Further Details:      
 
Domain Number 3 Region: 162-235
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 8.67e-16
Family Prohormone convertase 1 pro-domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3293
Sequence length 835
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1:3301737:3309675:-1 gene:WBGene00223554 transcript:Bm3293 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-kpc-1
Sequence
MALSRKCANPTYKHSVWDNQKSAHGIYRVKINNETSVHTLNSVAKNELACCSNADVFKFP
IMNEENSVLKGNCTTYQICPLNRNYRSLSRQHFRIPVTSLLFIVLSLAFLSMPQFSSVAA
DELNSSDAVIELTPVGGSNNHNNGSYGTGTSQSSSTALRKAYTNQFAVRITGGDTLEADK
LAAKYGFINLGRVLPNDEYFLFESRQTRKRSTRRRRNAQTNSIAREPKVEWIEQQIAKKR
VKRDYMLMNTLSSTVHLQRFKGNEISDDLTIIGSDDVQQQYASSRNRNADIRSVGNYNLN
DPLWSDMWYLNAAAYDRGLDHNVREAWDLGYTGRGVVVTILDDGLERTHPDIAPNYDSKA
SYDVNDRDEDPTPRYDYTDENRHGTRCAGEVAAIFNNSLCIVGIAYNARIGGIRMLDGDV
TDAVEATSLAHNSDHIDIYSASWGPDDDGRTVDGPAKLTRRAFEKGIREGRRGLGSIFVW
ASGNGGKDADSCNCDGYTNSIYTLSISSATEHGNIPWYSEACSSTLATAYSSGATGEKMI
VTTDLHHSCTNAHTGTSASAPLAAGIVALTLEANPKLTWRDMQHIVVRTARPLNLRAGDW
VTNGVGKKVSHSFGFGLMDAGAMVRLANNWTTVPEQRKCVVFYPARYKIVPHGNRLQLQL
YTDGCSSYSRNKVGYLEHVQAIITLTAPKRGDIQIYLTSPSGTRSTLLAKRARDTSRTGF
REWAFMTTHNWGEMAVGLWTLEINNDGWDDAELIRWDLVLYGTATEVSNIGGTPSASSSS
LTPRSLSSKVRNRYGALWEDTSAASIITASNIIALFFLLCFIYLNFPSGDFFFFF
Download sequence
Identical sequences Bm3293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]