SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3370 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3370
Domain Number 1 Region: 20-128
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.03e-29
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 2 Region: 143-230
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000144
Family Ankyrin repeat 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm3370
Sequence length 750
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold5:709638:714935:1 gene:WBGene00223631 transcript:Bm3370 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-git-1
Sequence
MIADMSSQYVTSSVAGRPFQCADCSAADPQWASLNRGVLICSECCYIHRNLGRHISHVRS
IKKGAWNSSQLELMYVLYSNGSNNIWEHSLLDPQSTNKIRRKPTPHDPVLPIKENFIKAK
YAQMAFALRPAKDDNCISQDDLNRQLWSCVRTSHVETTMRLLALGADPNYTDPEKHNTPL
HVSAKENQALQVELLWIYGADPAQLNAIDLTPSQVAKLENHIELAARLEQLQFEVTNRLT
MFLCGRRPDHSKQQYFLIPELAGQYTENVQMKSARRRLRSLPSYYFERFVQDVYDEVDRR
ETVTAWNAVIQGIQPFSLGNDHCVAVFLPPNPELSATRNQLRQKLAKCDVRGFATLIIDI
LSEAKRRYYGLPLKNDTDDSAENLLKKTSDSMDRLNISSMGTSEDYDEVADSLQNGKWRT
SGSTRKSSERKSDDSGDLLQETGPVMIDDFLELKEKLANTEGTLAAVQQTNTQILRMLTH
LQSNIDRLNADNADVHDQLKKVKTTCSQAVGRRRSSQSPALSPGTSVSTSVLGSKNITST
YHASTEKSVTASQNPDMHGAFGRASRRHGLTSLMNTTGRTIAQHRSFSLRQGTVQQTEYS
SGVEGLDPHFGISCCEKTDLLNAVDERTEEERMRSSYRSIGAFTDNLIAETEQLTHAIKL
LLTDAQYGQLQARAPDHAYSVAILISRILTIIPEERRTPAVETCLQRMSDSTVILSAKCN
APTFSVNDTCAAAFAVANSAKQLLVNVHQF
Download sequence
Identical sequences A0A0H5S6S8
Bm3370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]