SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3816 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3816
Domain Number 1 Region: 7-153
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.34e-47
Family Ankyrin repeat 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3816
Sequence length 168
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3131:326:1647:-1 gene:WBGene00224077 transcript:Bm3816 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm3816
Sequence
FIFSFLKNGWSPLMEACALGHFSVAQILLDHHARVDVFDENGRTALHLAAANGHLKLTQL
LLTSKAFVNSKSKTGEAPLHLAAQNGHVKVVSVLVEHHGALLEAITLDNQTALHFAARYG
QLTVAQTLLALGANPNARDDKGQTPLHLAAEVYQINFNKRSIFLFQKI
Download sequence
Identical sequences A0A1I9G7R9
Bm3816

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]