SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3929c from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3929c
Domain Number 1 Region: 1368-1470
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-22
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1492-1530
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000981
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm3929c
Sequence length 1561
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1:3762336:3774069:-1 gene:WBGene00224190 transcript:Bm3929c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-sur-2
Sequence
MGTTTEAIATSATSLTAAVGNDAEKLQWIVLNQVEGVQMREMFWDLSKDVDVDVLACSEA
VKMLRTMTEEEKTQCCKASLSLLSNKDDPRYIHYERILSSIFMIACNEGVLPLSDCCELL
ILCTNFSLTTPMDSRKFEYMQKNLHLIDYKGLRNILKLLVVERMQEVPSTITHHHRHMLL
PVENMLLTLIDRQLNLLPCIFTITELHRVSNNSRAFLLPRVAKKFNDMFISFRPLTEMVT
IIGRSWLYPIAAHISFPVSTPSWKLEVTTTRLHQRAHLPYKSELFAPQSFLLYTLLRQPR
GKDTISYVMRQNTSLTPQRLQCDELLHMIILEAMSEMEKTDTRLDDPANQYQWMNITQTL
SETVYRKGRDELMWVILQYVAVYIDRVSNEEMVRVAEIYNLLYSDEQTWSGADTDPLLFV
RFLVPAAIWIHFYKKLGNSHTEILPKPSESLWRQIQFLQERTADSDPNIQNVADHNAVLA
AVANAYSSDMPNFQKLVLTAVDVFLDGSPEEMNTVWHLPYGIISYSKKTPLPLSLIDSLT
FHARNHLFQLCLLKLTAMLSIQQAQKVPSPATIDTLVRLAVTTEFEYGVKQVLALLSSTL
ASVNKSTNLGPAQQDRSRDLLFVLCDILSYRFISYPFPVGSKINLMLWCYTALGNSQVQM
NIVLCSALEQVMMRYWMWNSPQEMFYLSNAFLGMEMTAEMMQRCNVNFCWPLSINRTYSS
QLIGCNVDDGAADTVIYDELMHRVIQEVHQVQEIIYAQGLAAEEQLLKFFSGERRQTIFC
VVYNMLFETKKIHPVIYSVLSSMNNKELTATINKFTDYFIFIFKKNLPSDDQQFTAMIGI
LNDMAFNLHLIPLDRLLISLVLHPTDDGATEIAMLIIHSLVGSYPDLHNRITALVHIIPS
NKIGNSGAAFFNKMSEYYSQFPELSYREMEAKMRREMQIELGMRPIEQSTVNPELHMPIY
YGNIMERILPIVDIILLRAIETVVADQLFTTLLMCFKPCYRYHPQPAAYMYSVLYCLDKT
ISHTVRARDFVLEICGQLEDRDGKYALLTPSFISDNHQLSLPSQFCQALVDRILQASNYA
HQPPAFVYKDWRFAEMPPAGQALTGACIELLASPHAPVITAHALIDLVFIRPLHQPYATI
NAVALILTALPVSFQQVFYDHIVSVLDSEALHGDPSVCFGSLESECLLLTENQLLTNLAL
GHAYLQHCNTSSLAALPEFVRDQLAPKLVTEAQLIFVLRLVVPILQRFYDAKERSKQIQD
LAVDVYKMTVKVNERVGLLKYEDSICDFLYHMKYMYVGDFVKNEAEQAIQRLSPSMRNKL
KYISHTQMNTAIDLPHKLAPGPSNLDVVRRDVWMEHGAASHTVQFSQTMKLIRGSSWYWG
NMSWKDAEKVLMSQLPGTYLVRDSASDRYIFTISYRTKHSVHHTRLAQHGGNFCLGGPNS
LVKANSLVSFIENSLQSCCKRRICMLMHPKSDSTGIETLELNHLLRRHELLPSLKYLCRV
VIRNCVEKELLASLPLPSNMICYLEDPKYFVPPCLYQICIYNGIMFILIFVLANNQALIM
K
Download sequence
Identical sequences A0A158PZC4
Bm3929c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]