SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3929d from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3929d
Domain Number 1 Region: 1445-1547
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-22
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1569-1607
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000105
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm3929d
Sequence length 1638
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1:3762336:3774069:-1 gene:WBGene00224190 transcript:Bm3929d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-sur-2
Sequence
MGTTTEAIATSATSLTAAVGNDAEKLQWIVLNQVEGVQMREMFWDLSKDVDVDVLACSEA
VKMLRTMTEEEKTQCCKASLSLLSNKDDPRYIHYERILSSIFMIACNEGVLPLSDCCELL
ILCTNFSLTTPMDSRKFEYMQKNLHLIDYKGLRNILKLLVVERMQEVPSTITHHHRHMLL
PVENMLLTLIDRQLNLLPCIFTITELHRVSNNSRAFLLPRVAKKFNDMFISFRPLTEMVT
IIGRSWLYPIAAHISFPVSTPSWKLEVTTTRLHQRAHLPYKSELFAPQSFLLYTLLRQPR
GKDTISYVMRQNTSLTPQRLQCDELLHMIILEAMSEMEKTDTRLDDPANQYQWMNITQTV
TFSLLHGNASFARLLKILYESLSETVYRKGRDELMWVILQYVAVYIDRVSNEEMVRVAEI
YNLLYSDEQTWSGADTDPLLFVRFLVPAAIWIHFYKKLGNSHTEILPKPSESLWRQIQFL
QERTADSDPNIQNVADHNAVLAAVANAYSSDMPNFQKLVLTAVDVFLDGSPEEMNTVWHL
PYGIISYSKKTPLPLSLIDSLTFHARNHLFQLCLLKLTAMLSIQQAQKVPSPATIDTLVR
LAVTTEFEYGVKQVLALLSSTLASVNKSTNLGPAQQDRSRDLLFVLCDILSYRFISYPFP
VGSKINLMLWCYTALGNSQVQMNIVLCSALEQVMMRYWMWNSPQEMFYLSNAFLGKQGKL
AVIFNTANPAFCDPQHGNVSVEQQYTNSHISLELLRCLLLSMFRSLKMTGMEMTAEMMQR
CNVNFCWPLSINRTYSSQLIGCNVDDGAADTVIYDELMHRVIQEVHQVQEIIYAQGLAAE
EQLLKFFSGERRQTIFCVVYNMLFETKKIHPVIYSVLSSMNNKELTATINKFTDYFIFIF
KKNLPSDDQQFTAMIGILNDMAFNLHLIPLDRLLISLVLHPTDDGATEIAMLIIHSLVGS
YPDLHNRITALVHIIPSNKIGNSGAAFFNKMSEYYSQFPELSYREMEAKMRREMQIELGM
RPIEQSTVNPELHMPIYYGNIMERILPIVDIILLRAIETVVADQLFTTLLMCFKPCYRYH
PQPAAYMYSVLYCLDKTISHTVRARDFVLEICGQLEDRDGKYALLTPSFISDNHQLSLPS
QFCQALVDRILQASNYAHQPPAFVYKDWRFAEMPPAGQALTGACIELLASPHAPVITAHA
LIDLVFIRPLHQPYATINAVALILTALPVSFQQVFYDHIVSVLDSEALHGDPSVCFGSLE
SECLLLTENQLLTNLALGHAYLQHCNTSSLAALPEFVRDQLAPKLVTEAQLIFVLRLVVP
ILQRFYDAKERSKQIQDLAVDVYKMTVKVNERVGLLKYEDSICDFLYHMKYMYVGDFVKN
EAEQAIQRLSPSMRNKLKYISHTQMNTAIDLPHKLAPGPSNLDVVRRDVWMEHGAASHTV
QFSQTMKLIRGSSWYWGNMSWKDAEKVLMSQLPGTYLVRDSASDRYIFTISYRTKHSVHH
TRLAQHGGNFCLGGPNSLVKANSLVSFIENSLQSCCKRRICMLMHPKSDSTGIETLELNH
LLRRHELLPSLKYLCRVVIRNCVEKELLASLPLPSNMICYLEDPKYFVPPCLYQICIYNG
IMFILIFVLANNQALIMK
Download sequence
Identical sequences A0A1P6C0A0
Bm3929d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]