SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3929n from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3929n
Domain Number 1 Region: 1390-1492
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-22
Family SH2 domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1514-1552
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000981
Family SOCS box-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm3929n
Sequence length 1559
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1:3762584:3774069:-1 gene:WBGene00224190 transcript:Bm3929n gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-sur-2
Sequence
MGTTTEAIATSATSLTAAVGNDAEKLQWIVLNQVEGVQMREMFWDLSKDVDVDVLACSEA
VKMLRTMTEEEKTQCCKASLSLLSNKDDPRYIHYERILSSIFMIACNEGVLPLSDCCELL
ILCTNFSLTTPMDSRKFEYMQKNLHLIDYKGLRNILKLLVVERMQEVPSTITHHHRHMLL
PVENMLLTLIDRQLNLLPCIFTITELHRVSNNSRAFLLPRVAKKFNDMFISFRPLTEMVT
IIGRSWLYPIAAHISFPVSTPSWKLEVTTTRLHQRAHLPYKSELFAPQSFLLYTLLRQPR
GKDTISYVMRQNTSLTPQRLQCDELLHMIILEAMSEMEKTDTRLDDPANQYQWMNITQTV
TFSLLHGNASFARLLKILYESLSETVYRKGRDELMWVILQYVAVYIDRVSNEEMVRVAEI
YNLLYSDEQTWSGADTDPLLFVRFLVPAAIWIHFYKKLGNSHTEILPKPSESLWRQIQFL
QERTADSDPNIQNVADHNAVLAAVANAYSSDMPNFQKLVLTAVDVFLDGSPEEMNTVWHL
PYGIISYSKKTPLPLSLIDSLTFHARNHLFQLCLLKLTAMLSIQQAQKVPSPATIDTLVR
LAVTTEFEYGVKQVLALLSSTLASVNKSTNLGPAQQDRSRDLLFVLCDILSYRFISYPFP
VGSKINLMLWCYTALGNSQVQMNIVLCSALEQVMMRYWMWNSPQEMFYLSNAFLGMEMTA
EMMQRCNVNFCWPLSINRTYSSQLIGCNVDDGAADTVIYDELMHRVIQEVHQVQEIIYAQ
GLAAEEQLLKFFSGERRQTIFCVVYNMLFETKKIHPVIYSVLSSMNNKELTATINKFTDY
FIFIFKKNLPSDDQQFTAMIGILNDMAFNLHLIPLDRLLISLVLHPTDDGATEIAMLIIH
SLVGSYPDLHNRITALVHIIPSNKIGNSGAAFFNKMSEYYSQFPELSYREMEAKMRREMQ
IELGMRPIEQSTVNPELHMPIYYGNIMERILPIVDIILLRAIETVVADQLFTTLLMCFKP
CYRYHPQPAAYMYSVLYCLDKTISHTVRARDFVLEICGQLEDRDGKYALLTPSFISDNHQ
LSLPSQFCQALVDRILQASNYAHQPPAFVYKDWRFAEMPPAGQALTGACIELLASPHAPV
ITAHALIDLVFIRPLHQPYATINAVALILTALPVSFQQVFYDHIVSVLDSEALHGDPSVC
FGSLESECLLLTENQLLTNLALGHAYLQHCNTSSLAALPEFVRDQLAPKLVTEAQLIFVL
RLVVPILQRFYDAKERSKQIQDLAVDVYKMTVKVNERVGLLKYEDSICDFLYHMKYMYVG
DFVKNEAEQAIQRLSPSMRNKLKYISHTQMNTAIDLPHKLAPGPSNLDVVRRDVWMEHGA
ASHTVQFSQTMKLIRGSSWYWGNMSWKDAEKVLMSQLPGTYLVRDSASDRYIFTISYRTK
HSVHHTRLAQHGGNFCLGGPNSLVKANSLVSFIENSLQSCCKRRICMLMHPKSDSTGIET
LELNHLLRRHELLPSLKYLCRVVIRNCVEKELLASLPLPSNMICYLEDPKYFVPPCLYQ
Download sequence
Identical sequences A0A1P6C0A1
Bm3929n

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]