SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm3988c from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm3988c
Domain Number 1 Region: 150-232
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000542
Family Galactose-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm3988c
Sequence length 364
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3:1356244:1369692:1 gene:WBGene00224249 transcript:Bm3988c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-unc-6
Sequence
MCQRSSECWRNGVRRLLNCRVENVWNEVSRIGNEYYEQFLSNTQVVCNCGFHAINNLYAE
MYSLLTFTLFFLLRIYHIWAAYFSQFSLREPEHDPCYDNAGRPIRCVPDFINAAFGKPVT
ASNTCGQYGPSRYCSLRENAMGVMEEVCNICDASSKTQSHPASHLTDLNNLQNVTCWMSE
PSTEYPHNVTLTLSLGKKYELTYISVQFCNRLADSMAFYKSMDFGKTWIPFQFYSTECQK
IYDRNPSIKIGKHNEQEALCTNTHALTSMPNRVAFATLEGRPSAFEFEHSPVLQDWVTAT
DIRIIFNRLSPDQAELYGLTNEIGVNITDMDQLKQRYYYSVGELAVGGRCKYISFGPPVG
PRYL
Download sequence
Identical sequences A0A1I9G4X4
Bm3988c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]