SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm4150 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm4150
Domain Number 1 Region: 73-151
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000328
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 2 Region: 1-36
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000011
Family Ankyrin repeat 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm4150
Sequence length 202
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1067:5679:6593:-1 gene:WBGene00224411 transcript:Bm4150 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm4150
Sequence
DSDGWTPLHCAASCNNLPMVKLLVENGACIFAQTLSDLETPAEKCEEDEDGYEGCQLYLK
AANQEAGIINNGFMYAAYDYDKVQDDELSFSIGSCLRVLEKDTNDHAWWFCEITTTEICD
NESEISKRGLVPRNYLSLYPSLSKRSANFQMFDLSQLPRIHDSKNDNIDVKEWRTSNSVI
EKITEKNDDEAIVEQTLPITVS
Download sequence
Identical sequences A0A1I9G8D8
Bm4150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]