SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm4501c from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm4501c
Domain Number 1 Region: 329-473
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-19
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 2 Region: 482-523
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000754
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 181-235
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 4 Region: 218-355
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 152-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number 6 Region: 509-556
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm4501c
Sequence length 754
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3:557149:570205:1 gene:WBGene00224762 transcript:Bm4501c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm4501
Sequence
MLSMELYNVASFIDASELSHCCTIGKIHFEQLLSCAEIKLNETASTCILTASICCMDTLL
EHNCNYGIKMAESEDQCLLNITDIGGGIRKECCECCLLAKELSRNDKSCVAPNGFGAACL
RSFHQCCFENAKSKQYHRNSDLLDLLSVGDRCISTKCEHLCTDRGGATVECSCHPGYELG
PDGYSCIDIDECLLLADDCLESQRCLNTPGSFKCIRTLSCGTGYALDSDTEQCIDVDECN
LGSHDCGPLYQCRNTQGSYRCDPKKCAEGELMNPRTGECTNMDCPIGYKPIRGRCEDVNE
CEIIGRCAQFEECINTPGSFRCQERGNLCTNGYRMDRDTGFCVDINECADGTHFCGDKQC
INLLGSYKCRCSAGFEFNDTTKRCEDVDECKKFAGHVCSLHATCENTYGSFKCHCKDGFK
IAKDARNCDDIDECSLGKANCAQKCINIPGSYQCICERGYRLGADGVTCEDIDECTLWAG
SGDDLCMGRCINTPGSYKCQCPVGYEIQEDGRTCKDVDECAKGECQGNDQICVNTLGSFK
CHVIRCPLNYMHDKNYKNRCNRLSHLCDSLTEEACKNHAIRISWEFTSIPKQEPISSRRT
SITLFTVRGPTSPSSNVQFELKLKSAIPEKFYVLPAVRSNFLLQKSEEKNGAIIALRDSL
DGPQEISHVRAQMDTPFSVEYKIDKANRDRFVVQQDQNIGIVKMIAPIEGPKTVVVMLHL
NIYSRSHVLLTHNIAIITQAVCVLFHLRTSRDIF
Download sequence
Identical sequences A0A1I9G4X5
Bm4501c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]