SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Brugia malayi WS250 > Bm4548

Domain assignment for Bm4548 from Brugia malayi WS250

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	Bm4548
Domain Number 1	Region: 19-69
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000000292
Family	EGF-type module	0.013
Further Details:

Domain Number 2	Region: 150-178
Classification Level	Classification	E-value
Superfamily	Notch domain	0.000000889
Family	Notch domain	0.0048
Further Details:

Domain Number 3	Region: 63-103
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.00000125
Family	EGF-type module	0.019
Further Details:

Domain Number 4	Region: 185-216
Classification Level	Classification	E-value
Superfamily	Notch domain	0.00000314
Family	Notch domain	0.0067
Further Details:

Domain Number 5	Region: 100-137
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000108
Family	EGF-type module	0.022
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Protein sequence

External link(s)	Bm4548
Sequence length	258
Comment	pep supercontig:B_malayi-3.1:Bmal_v3_scaffold2:667312:669378:-1 gene:WBGene00224809 transcript:Bm4548 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm4548
Sequence	MVLINVALALLNCLLALPSCFDPAEPCLNGGVCVKQVTNKAHSTLCSCSAGYSGEKCEKV LNVCEAFPHYCNAGTCVSINGSAICHCSMGYFGHNCEYTFDKCKVGNMCRNGGTCIDGIC FCTDGFSGEVCERHVPERDDYLRAGCEEHPEFCALRFADGTCNEECNNEKCFFDGFDCVV STQECRLSDYCALHYLDGKCDEKCAVAECGYDGMDCDRNMLLRDLTDSSTIGIVFEGPLP NILDKIYSLLAKLAQISC
Download sequence
Identical sequences	A0A1I9GD88 Bm4548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]