SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm4552 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm4552
Domain Number 1 Region: 61-210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000638
Family Growth factor receptor domain 0.0053
Further Details:      
 
Domain Number 2 Region: 268-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000434
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 229-273
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000766
Family EGF-like domain of nidogen-1 0.041
Further Details:      
 
Weak hits

Sequence:  Bm4552
Domain Number - Region: 28-76
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0565
Family TNF receptor-like 0.013
Further Details:      
 
Domain Number - Region: 12-37
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0647
Family TNF receptor-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm4552
Sequence length 309
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1176:1639:4602:1 gene:WBGene00224813 transcript:Bm4552 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm4552
Sequence
MVIINYFSSVVLCEPGHYHSLLSKRCEHCPRGYYQHRSGRPRCNKCPQGYTTLAIGSLNV
TACVVECSAGYFLNEITDKCEPCGYLAYQPNSGSTYCLPCPQNTVTLSINSTLIDQCIEN
CPAGQEHSSDGGCKPCQRGFFKESNDLLCRPCDPTYTTESVGSVSEKSCILPSCQQGYYL
NWYYKQCLNCSYGYYQDEIGSNACKQCPSGTTTRILGATSIETCVSTNQCASGEHRCHWL
AACIDLPDNENKPAYSCRCQPGFVGNGFTCTDICLNLCYNNAECIKTSRGEPRCICKPGY
RGLRCEIKK
Download sequence
Identical sequences A0A0H5S0Q7
Bm4552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]