SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm5018c from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm5018c
Domain Number 1 Region: 39-196
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-44
Family Ankyrin repeat 0.00019
Further Details:      
 
Domain Number 2 Region: 811-898
Classification Level Classification E-value
Superfamily DEATH domain 1.44e-16
Family DEATH domain, DD 0.0051
Further Details:      
 
Domain Number 3 Region: 217-240,294-370
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000041
Family G proteins 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm5018c
Sequence length 943
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold20:196789:208765:-1 gene:WBGene00225279 transcript:Bm5018c gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-dapk-1
Sequence
MQIGTISPPPCSRLTPVTTKFISLITDMHQDWDQYCSSATDGETALHCAVARGHVECVQS
LLDAGAPVDAVDQVGQTALHLALRRSHIDIALLLITKGCKLDVQDENGDTALHIASRIGL
LSAVQTLCHLGAVIDVVNQNSLTPLHIAAKEGHIEIIRCLCLFGANVLRKNKDGLTAEII
ALAQEHTQIGTLLAKMKLDQTRDAYVEQLCPLEMPLRRIKLKVFGHAGVGKTRLICSLQS
GSVIGSIIGAVQRRFSDNPSPSSSTTASNPSQDEGVNSFDDSVESNNNMKSGRRRAVPHL
QYTRGIDVQNVTLQGCGEFSVWEFGGYEPYHMAYDHFVGNTDCVHVIVYRCTDPTEIQYK
QVLYWMNFLKGRVTPSEPIGHCGIISRRSKVVIVGSHATPALFPLRNSDGDYVSSDGEAM
LKTVRLRFETHFDIHDQLILLNSTQNNCPGMKSLKIYLSKAREFILSRLQKPLGLLDTTV
QYISGVRKQHAFFPVITWPHFTTLVRNEVNSLAGDNHCRQLIQQLQLIGEVVYLRDEVSE
LDYVVLSPEWLGTHVLGNLLSAEFLSHCRINGCYSIDDFAPIYPEIADPADLLRILDTLQ
LCAPTDSDGEAEFEFPAFNVLDPPKDIWQRDRPTYVYGGVRVLPMRGMERSLQSTFPRIQ
VALRRSMHDFQDPMDADLMQWNSCSKMSSGQMEALVRLHGDAVEIQVRGPCEIATSCFYF
LEDITNLVEQTAQEVAPGISLERHFLSPKHLREHFSNPAVYAPETIMAMQQAESLTIRNN
QEGDELFTDVVCFGSRDVAALLTLGIDVGVAQLQLASRCELAALLDPSDAMGRDWSILAV
KLNLTDQLPEVDSTGQSLSRTDQLLAEWALQCPETATVGRLCTVLEELGRQDARDALYRT
VPLYLFAPMDEQPVVHLTEYGDSGVVSSTQSTTDPRSASTLSR
Download sequence
Identical sequences A0A158Q020
Bm5018c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]