SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm6578 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm6578
Domain Number 1 Region: 147-361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.84e-56
Family SPRY domain 0.000000112
Further Details:      
 
Weak hits

Sequence:  Bm6578
Domain Number - Region: 350-387
Classification Level Classification E-value
Superfamily SOCS box-like 0.00248
Family SOCS box-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm6578
Sequence length 389
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold27:181656:185166:-1 gene:WBGene00226839 transcript:Bm6578 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm6578
Sequence
MNSSFTIENKADVSSLTGSLRDDIVVGSSDAVVLSSTQQPAIRQNVSARRVVRPSRETQV
GSNMTEECVSSTVTEISGSGSSSSLRRQHLFNRSHRASREQTVAVRNLNCASSSTSHTTT
MVVELNGSHSRTQSNANPVGSCYEDMFRPSRFDQIISSSPPPLEVMEAYAWNPDDRSLNI
FVKDDDRLTFHRHPVAQSTDSIRAKIGFSKGFHVWQIKWPQRQRGTHASVGVATKAASLH
AVGYTSLIGSNSESYGWDLIRNKCYHDSKNTSGWTYPKSILLDENHLAPDQFYCILDMDE
GYMAFASDVDYYGVAFTGLKGRELFPVVSAVWGHCEITMKYLGGLDPEPLTLLELCRRSI
RTYLGKERICRVRELRLPAGLKKYLLYKC
Download sequence
Identical sequences A0A0H5SGN5
XP_001900109.1.25112 Bm6578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]