SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm6793 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm6793
Domain Number 1 Region: 111-261
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.66e-43
Family Hypothetical protein AT3g04780/F7O18 27 0.00011
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.79e-28
Family Thioltransferase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm6793
Sequence length 283
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold23:463049:465276:1 gene:WBGene00227054 transcript:Bm6793 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm6793
Sequence
MVVHHCNSDAGFHEFLANAGAKPVIVDFYAIWCGPCRRIAPIFEQLSNQYLNVAFLKVDV
DKAKDLSTLQGVTAMPTFIVYMNRVKVDLLRGGDPNALEALVKKWSDNAPKEDSLVVGQT
DLITFVDKTQVECLNEDDNATLRSLLNGKGVLTSDCDPQLIISIPFNQPVKIHSIYLKGS
GPSAPKTVKIFTNLASILDFDRAAGAESVQTISFSEKAVEGELCNLRYVKFQSVKNIQLF
VEDNQGGTENTTIEALRFYGTPLSATNMQDFKRVSGKVGEVGH
Download sequence
Identical sequences A0A0H5SRG5 A0A0N4T0Z3
Bm6793 XP_001892562.1.25112 Bm1_05440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]