SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm6818 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Bm6818
Domain Number - Region: 19-76
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0392
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm6818
Sequence length 111
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold36:75542:76829:-1 gene:WBGene00227079 transcript:Bm6818 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-phf-5
Sequence
MAKHHPDLIFCRKQPGVAIGRLCEKCDGRCVICDSYVRPCTLVRICDECNYGSYQGRCVI
CGGSGVSDAYYCKECTIMEKDRDGCPKIVNLGSAKTDLFYERKKYGFKKNG
Download sequence
Identical sequences A0A044V9H3 A0A0J9XZ30 A0A0N4TXB4 A0A0N4UMH3 A0A0R3RJ44 A0A1S0TXU2 J9EUY7
WUBG_03103T0 Bm6818 LOAG_06442T0 XP_001896464.1.25112 XP_003142026.1.37734 Bm1_25020 OVOC9235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]