SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm7108i from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm7108i
Domain Number 1 Region: 305-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000132
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 2 Region: 436-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000599
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 3 Region: 280-317
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000141
Family EGF-type module 0.017
Further Details:      
 
Domain Number 4 Region: 239-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.019
Further Details:      
 
Domain Number 5 Region: 477-521
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000027
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm7108i
Sequence length 748
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold6:1768163:1777055:-1 gene:WBGene00227369 transcript:Bm7108i gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm7108 description:Delta-like protein [Source:UniProtKB/TrEMBL;Acc:A0A0K0JQY9]
Sequence
MGYNILRLCSCAGSFEIRLVSLTVGSKEEFRPELRICLKHFEKRISYNGECTFGEVTLDA
ERLRNGTKIEFQFGWPESFTLITEAWRTTGNLKKLMSHNGFQRESIPSGKTWIEETLVGT
NGFRMRIAYRITCANDYYGPRCLTFCQPMSSTVGHFQCTSNGSLACSPGWEGSSCDIARC
DNCINGACDRPDSCRCKTGWTGPNCDQCVRYPGCKHGTCKTPNQCICDEGWGGHFCNEDL
NYCTRHHPCRNNATCRNTGHGQYTCECPDGYTGTDCEIRVQNCSLQPCLNGATCSDMPGN
TYICTCSKGFTGRYCQVAATSCSDSPCQNGATCAEIGGVFLCTCLQGWTGTTCDIEINPC
DKVHCFNGGKCVKKNVAGDYDCLCPLGFTGRHCEENSNECAQLNPCMNGGRCIDEVNNYK
CQCPDGYSGTLCQDSVSACLNEPCMNGGQCIDIEGGGYYCKCRIGFRGSNCKIAEIGCHR
SSCSNGGTCVDSFQGFRCLCPPCFYGESCLHLQSECQPLQHYNRTRTFVVKIENEQQTSN
GGLNFRDMLLILLSSCCILALMSIVIIFYRQKLAKRTSSLDPTFQNDRNSRILSKYSEQK
PCLSICTNLDAEINYFERDVTNKIQTISGKKKLAAHPGCEHLDYNERYAIEPTVNMMLPS
LKNVGCCNKVDIRHSKRFEHSPLPTQLCEDGGSYYEEIDGELSIPEVISQQTNNESQSNI
VNRRVTPDNNSRQVQDIIHKVTDIQTNL
Download sequence
Identical sequences A0A1I9G3S8
Bm7108i

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]