SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm7267 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm7267
Domain Number 1 Region: 79-187
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.38e-28
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 2 Region: 9-82
Classification Level Classification E-value
Superfamily SH3-domain 4.07e-21
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm7267
Sequence length 222
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold170:59757:61359:1 gene:WBGene00227528 transcript:Bm7267 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm7267
Sequence
RKSMTESKPPKPAPKPGRVTVYRALYDYKAQNDKELSFSEGDLLYVSDSSNDVQWWPARC
RNQIGLIPANYVKTAEYIEYPLHDAAKRGNIEYVRECLDNAVSVNGLDKSGSTPLYWSSH
GGHVAVVKLLCSIPSICISAQNKIGDTALHAAAWKNHLECVEVLLKYGANTTIQNNERKR
PIDLAGDPEIRALIQLAMRQTVDTSNFRNDYSSESEQEIDDI
Download sequence
Identical sequences A0A0J9Y8S5
Bm7267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]