SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm7457 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm7457
Domain Number 1 Region: 20-170
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.55e-42
Family Hypothetical protein AT3g04780/F7O18 27 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm7457
Sequence length 205
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold4:2200000:2201156:-1 gene:WBGene00227718 transcript:Bm7457 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm7457
Sequence
MGSNFHCENEAVNFERKNEGMRYTINSHIDLQKVIVLNEAVEGSGAKIFKKWEDRLDRTI
YVASDLDEELLFNVPFKGHVKITGLVLSGDLDGTHPSYIRLYKDRPSMSFEATTLESDQE
FPLKQDMNAQIDYPIKASKFSNITHLSLHFPTNFGESKTRIYYIGLRGEYITDIRQQICI
TTYEARPLLEDHKGKIPDVIKRSVM
Download sequence
Identical sequences A0A0H5SB75
Bm1_44930 XP_001900448.1.25112 Bm7457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]