SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm7849 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm7849
Domain Number 1 Region: 17-113
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-19
Family Ankyrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm7849
Sequence length 117
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold1156:3520:4576:1 gene:WBGene00228110 transcript:Bm7849 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm7849
Sequence
MSLKRALNESDMIGTARILDSFPSEIFSRDSEDRLALHYAAETADAETFKRILEMDHSLI
HCQDQNGYTPLLIASMSGNVPAIKLMIENNIQINHIDKEKHSAVHWAVACGQVGLLY
Download sequence
Identical sequences A0A0H5S0R8 A0A0R3RAF4
Bm7849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]