SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm8300 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm8300
Domain Number 1 Region: 3-67
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000196
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm8300
Sequence length 74
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold402:1:225:1 gene:WBGene00228561 transcript:Bm8300 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm8300
Sequence
TVCSNKCPKFCPNPDLLNCTELAYDPCECCTVCLHDTGESCGPGIGACRQPNFCQPKLDQ
IDIGICSGKLVRTI
Download sequence
Identical sequences A0A0J9YCK5
Bm8300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]