SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm8702 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm8702
Domain Number 1 Region: 110-218
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-26
Family SH2 domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 221-262
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000235
Family SOCS box-like 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm8702
Sequence length 295
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold408:15857:18256:1 gene:WBGene00228963 transcript:Bm8702 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm8702
Sequence
MEAYSKRGRTIVRRIHMALLSCLPVNIIDNERLNVNEETGMNVELREIIVPSEVYPQQSV
QATRNCRLRFLFASDIAAEQPEPATRTLLQMPKDEPYIVHTSVHYTNCLVPRLDLIIDSS
YYWGIMDRYEAEALLDNKPEGTFLLRDSAQSEYLFSVSFRRYKRTLHARIEQKNHRFSFD
FSDPSIYSANTITKLISYYKDPTKCLFFEPQLSVPLPRNFVFSLQHLCRARIASLTTYDG
VEKLNLPVSLKNFIKEYHYKHPVKTVNYTPDTDLLHAYTLSSVEAMVTGANSAPS
Download sequence
Identical sequences A0A0J9Y9M5 A0A0N4TTA9
Bm8702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]