SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm11532 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm11532
Domain Number 1 Region: 4-107
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-24
Family Ankyrin repeat 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm11532
Sequence length 170
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3895:1:1332:1 gene:WBGene00231793 transcript:Bm11532 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-kri-1
Sequence
XLIQGMTANEKDNASWTPLHYCVFYNNLRATEVLLLHQGTDVNASNKVGSTALHFAALQG
NVYMVELLLSHSKIDVDAKDNSGRRPIDICACVPKLEYQKVAKLLLNWKRLNKIQVELMD
GGNAQLLLKHGQDTTAEELHAEMCKELKFNSDSGKLFAMWICSDRLSKFN
Download sequence
Identical sequences Bm11532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]