SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm1770m from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm1770m
Domain Number 1 Region: 183-273
Classification Level Classification E-value
Superfamily DEATH domain 2.05e-16
Family DEATH domain, DD 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm1770m
Sequence length 608
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold25:267034:274024:1 gene:WBGene00222031 transcript:Bm1770m gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-unc-44
Sequence
MDCQTPRDAARMAQEVYNEAISVPYMARFLIFARRTFPNEGQLRLFCMTDDREDKTLEKQ
EHFIEIAKSKDVEVLSGRHQFLEFSGNIFPITKSGDQLSLYFLPFQENRLAFMIKTRART
DNEAAADGRISFMKEPKMRAESLPPQTPLCTLAVTLPEYTGPISKKPFFSEALLTEKYTE
ALHETAEPDDLPLPHVARLIGADWHRLARALEVPDIDIRQVRHQLVGLEAITVLRIWMFL
KKEQATPAILRSALQRIGRDDVVREINRIEKPDDLEGTPVSHISEPSVTISSTSLEADDR
RHYSEVAATQQLMVEEPFFQQSEYYGIDGDTGGPKEQPFREEEEEVAVSEIRTVVRTERH
VHDSEDGERCFDTGPIVEERTITTTYEDDVAVNEEIVDRIVPLNEEEQEKWDRMVREAEM
NLEQQKESKEGTLDSQVTHEEKKDGDDGVILKTTRMGSSHVSQFLPDEAKTAANETGLSS
RDASIVMTPTGEEKVDHIGVREPSLSSAEPNIPTVTDQRHEAMAEGFTSEDGSVVVSKKM
TRVVTTTRTTFPGEKTESNMGDLIRLKVNEQVYSGSVDPGDQHIHLVPITKQRQQQKLDS
SDQQQQQH
Download sequence
Identical sequences A0A0K0J313
Bm1770m

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]