SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2232 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2232
Domain Number 1 Region: 63-106
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 8.5e-16
Family Transcriptional factor domain 0.01
Further Details:      
 
Weak hits

Sequence:  Bm2232
Domain Number - Region: 5-45
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00575
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm2232
Sequence length 109
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold3621:899:1510:1 gene:WBGene00222493 transcript:Bm2232 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm2232 description:DNA-directed RNA polymerase subunit [Source:UniProtKB/TrEMBL;Acc:A0A0K0J512]
Sequence
MLSEFCSECGTVLPIPATAPVTITCSYCRTQWHIKPIRNKLVYRSEKVYQNRVLNANEGA
LENPVVDKICDKCGHGKMSYACRQTRSADEGQTVFYMCLKCNYNMVENA
Download sequence
Identical sequences A0A0R3QFB7 A0A1P6BUA4
XP_001893050.1.25112 Bm2231 Bm2232 Bm1_07900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]