SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2618 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2618
Domain Number 1 Region: 108-380
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.11e-23
Family Extended AAA-ATPase domain 0.0031
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-20
Family Caspase recruitment domain, CARD 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm2618
Sequence length 569
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold259:40498:45506:1 gene:WBGene00222879 transcript:Bm2618 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-ced-4
Sequence
MLLEKDNRILTIATEALMQDFEPRDAIPFMCSEEIFTDDQQEVILSMTRRALRVMEFIRQ
YRKSANALDPLIAYFEKYGQKHLAHLLSKNYLPDERTLLTPTALEDRLFREGNVPRLPFY
RVLRVNLLEKLESLLVNLSSQDQFWLVIHGFPGCGKTFLAATVLHSHPILLSRYYEHVIW
VEDGRTNINQLPEVFSNFLFLATDALVLTGKETPVQFLPLAKTALREKPNTLVVLNDVYL
QESVRWFDQLNCRILATSRNLELFQVSSSNPILFAVDPPGFSFTETEVLFQQMRSSTTIT
SSSFHDHLFHIHKKTMGLPALLGIVRQQACDSNNDFYNLRYLLDYYSVTTISNFTYYKYK
NMVDAIMESYKTLTRRQKIIMETFIIFGYDQWIPLEIVSLCIPFDISGNQNILYTALQEL
EPLVKSSLLGKRIADLDGKVDNDMPFMYDFHINRIMYSFLCVTVNHQAIEDRLRLFIRPN
VSSFLLGNQRMDSNFMQRIHSYIDLRPYLFQKITYEECNLQNGLTVQYIESGLHNSSNSC
YINESDNGVIVRKESNNATKNWTDSCIFM
Download sequence
Identical sequences A0A0H5S4I0
Bm2618

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]