SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2767b from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2767b
Domain Number 1 Region: 39-175
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.46e-34
Family Galectin (animal S-lectin) 0.00072
Further Details:      
 
Domain Number 2 Region: 178-309
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.91e-32
Family Galectin (animal S-lectin) 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Bm2767b
Sequence length 311
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold65:95688:99776:1 gene:WBGene00223028 transcript:Bm2767b gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bm2767 description:Galectin [Source:UniProtKB/TrEMBL;Acc:A0A0J9Y6N7]
Sequence
MIKSFVSGKNLYILRKVRKECEKLINLSHVAHPGDAAIPVPYISKLGAKLQPGQTLVIHG
SIENDASEFEVNLLNGSPNIESSKATIFHIKVYFKENRLVYNTYENGKWGKEEKSSNPFK
KGDNFDLRIRIHEDKLEIFGNQKELHIYKARINVSSVEYLTIRGNISLKGVHWGGRYYTL
PFETQFPGGHLKADERIYVYGIPKGERFEIDFVSRNGDILFHFNPRFKEKQVIRNAQIGD
IWGQEEREGIFPFKKDIGTDIILHNAPYSIQIFIDGKRYGTFAHRTIKPDEDYMALRIAG
DFELTGMEFTI
Download sequence
Identical sequences A0A0K0J7D1
Bm2767b XP_001895582.1.25112 Bm1_20640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]