SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2833 from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2833
Domain Number 1 Region: 184-440
Classification Level Classification E-value
Superfamily Caspase-like 1.94e-78
Family Caspase catalytic domain 0.00000544
Further Details:      
 
Domain Number 2 Region: 10-106
Classification Level Classification E-value
Superfamily DEATH domain 3.01e-17
Family Caspase recruitment domain, CARD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Bm2833
Sequence length 445
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold8:1100014:1102990:-1 gene:WBGene00223094 transcript:Bm2833 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-ced-3 description:Caspase [Source:UniProtKB/TrEMBL;Acc:A0A0K0J7P0]
Sequence
MKEVMEDTVMTSERRRLLDKHLDTWTQSLQLDDVMVFLLSNSVFNEHIVDIIKSESTVAM
QRYQFIRQLKMRGNTAFSLFYQSLLKTNQRYLAHLMESGLSSEDKNNVGQEIEYKSTLHN
NPSTGENCQSIACHSPTPAAIQRNCSYYRSYECVKMREPAGILHDLMVDFIDTAANLSSF
DANLVYPNFSSPRGVALIINNRYFLDMPERIGTDVDEINLNNLFRQLNYAVSVCRNLCAK
EMLIAIQDFSKRPEHKHLDSCVVCVLTHGEHGELYGTDDVAISVLEFVSCLNARNCPALA
HKPKLFFLQACRGQQYDRGFGTEFDGPDGYFDRWFTCTTSQPKSSLPMEQKTKSPIEADI
LVSYATTPGYVSWRNSMKGSWFVQSICEVFAKYAKSTDILSMLTLVNKQVADAFESSSGS
FKQIPDHSSRLRKAFYFFPGTIKPF
Download sequence
Identical sequences A0A0H5S967
Bm2833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]