SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Bm2927d from Brugia malayi WS250

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Bm2927d
Domain Number 1 Region: 957-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000019
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number 2 Region: 299-349
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000131
Family EGF-type module 0.08
Further Details:      
 
Domain Number 3 Region: 846-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000053
Family Laminin-type module 0.00085
Further Details:      
 
Domain Number 4 Region: 747-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000586
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 5 Region: 461-516
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000248
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 1005-1053
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 414-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 8 Region: 919-959
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000165
Family Laminin-type module 0.0038
Further Details:      
 
Domain Number 9 Region: 803-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000363
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 358-416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family Laminin-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Bm2927d
Sequence length 1644
Comment pep supercontig:B_malayi-3.1:Bmal_v3_scaffold33:204038:220399:-1 gene:WBGene00223188 transcript:Bm2927d gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Bma-lam-2
Sequence
MIRILHRQPCRTNLRVLQLIYILIWIIEIVLSQPAEQNPSIDPNHHIPGSSPCYDDMNIP
QRCVPDFINAAFNLQVEVTNTCGVNGPVSYCVQTGHSGVRKVCDICDSRVETYAHPPAYL
TDFNNANNETWWQSETMNEGMQYPNSINLTLRLGKTFDITYVRLKFVSPRPESFAIFKKT
HPDDDWIPWQYYSGSCRSTYGILEKAPILPSNEAVAQCTREFSDISPLTGGNIAFSTLEG
RPSSQNFEESETLQEWVTASEIRIMLTRMNTFGDEVFRDAKVLRSYYYAISDFAVGGRCK
CNGHASECVKSTGDGEDRLVCRCEHNTMGADCDQCLPFYNDRPWQVGTAKEANECITCNC
SHLSNRCYFDQALFERTGSGGHCIDCAGNTQGAHCEECAPFNWRRPGEHYCIPCQCNEIG
SLSMQCDDHGQCPCKPGVDGHFCDRCMSGYYGFSISGCKNCLCDKTGSLNNEPVCDSETG
SCSCKLNVEGQQCNKCKPGYFDLSLDNQFGCTPCFCYGHSSICTSADGYYGMNVSSNFDS
GKEFWSAASLRGPEDIQWAEMDKAIAVSDIDGSPVYFVAPIQFTGDQRASYNQDLWFTLR
VQKAQVHPSARDILIVGQEGQELTIPIFAQENPIPSVNEQTYRFRIHANPVFQWSPRLNE
LDFIGILSNVSALKIRGTYSIEDVGFLSNVHLGSAGLATSADEPREAHWIESCNCLEGFI
GQFCESCAPGYRREIKYGGLFDRCVKCECHGHSTSCAPESGECICEHNTTGDTCERCSRG
YYGNALQGTPDDCTKCPCPEDGPCVLHTDGDIICTDCPTGYTGRRCDVCADGFFGNPGEG
KSCVECSCSGNIDPNSIGNCDSLTGECKKCIYDTVGFNCEECKPGYWGDALLEPKGDCKA
CNCFAPGTKRSNVDYVLLECRQSDGQCNCQPHVIGSRCDQCQPGYFNLTSGSGCQECNCD
VLGSVNSTCDVLTGQCLCKAGVMGRRCDQCEPQHYGFGLDGCQPCDCEVIGSESPQCDVI
TGQCLCRDHIEGRRCDHCIENRYNLQAGCLPCDDCYTLTQSRVHAFRNDISVLEETLKEI
VENPAPVDDVEFDNYVKAVSAEVEDLANVVNKKLAGGDSQIIEQVNMLRSDLKNALKLLS
SVDDIINKANKKATTIDETLKQWNLVKDRARSDLENALYYLETEGKTQWELAQEASRKYG
EQSQQLSEIAQEARKLAEQQENRSIEIEALAEKIANTSKQALVEAKEVIFGGDATSKEIA
IMMERLNATEKLLNQTRKLAEEQLTEADRAYKAAAESLTVVEGLRLPNIDPQQIEEEAKR
VAEDAKATADNAKEQAAANKELIDEAVRLIAEAKYELQRVQDQQKVSDELLADVDAAKAR
AMEAVSLAENTLTEAQHTLEILNDFQERVDATKSEAIEELRNLKEIEKEIALAEETTREA
ENAIGNAKNDARMAEKIALQAEKEAKSISKEAYELRNQTQYVRKTAEQLKSDANQLVSDV
KETSTTMEDYRRQASSDKARASEAVQKAQLAEKAAEDANKTISEAQDSLRSIINQLNSLD
GVNIEELDELEKQLDQAEELLNSADLDKQVSLLKEQKIEQDRTITQFRNEIDTLKDEVQN
LEEIRDSLPNKCFNVINLEQEGHK
Download sequence
Identical sequences A0A0J9XNX7
Bm2927d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]